Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR10G9 Peptide - C-terminal region

OR10G9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR10G10P

UniProt

Q8NGN4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR10G9 Rabbit Polyclonal Antibody (orb587674) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001001953

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RPGSRDVVDGVVAIFYTVLTPLLNPVVYTLRNKEVKKAVLKLRDKVAHSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICEBERG (CARD18) Human Gene Knockout Kit (CRISPR)
KN424896 1 Kit

ICEBERG (CARD18) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Fmoc-D-Orn (Boc) TentaGel® S AC Resin
SAD1120.25G 25 g

Fmoc-D-Orn (Boc) TentaGel® S AC Resin

Sign In for Pricing
View Details
Centrifuge Tubes
C2625-R 200 Units/Pack

Centrifuge Tubes

Sign In for Pricing
View Details
LDL Receptor (LDLR) (NM_001195800) Human Over-expression Lysate
LY434377 100 µg

LDL Receptor (LDLR) (NM_001195800) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Parotid gland
CS500820 5x 5 µm

Frozen Tissue Sections, Parotid gland

Sign In for Pricing
View Details
C6orf132 Antibody
KC-3702-01 50 μL

C6orf132 Antibody

Sign In for Pricing
View Details