OR10G9 Peptide - C-terminal region
OR10G9 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR10G10P
UniProt
Q8NGN4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR10G9 Rabbit Polyclonal Antibody (orb587674) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001001953
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RPGSRDVVDGVVAIFYTVLTPLLNPVVYTLRNKEVKKAVLKLRDKVAHSQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC881620-100 1x 100 µL
CD10 (Membrane Metalloendopeptidase) (MME/1620), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
PKSM041432-01 20 µg
Recombinant Mouse TNF Receptor II/TNF RII/TNFRSF1B/CD120b (C-6His-Avi) Biotinylated
Sign In for Pricing
View Details PKSM041432-02 100 µg
Recombinant Mouse TNF Receptor II/TNF RII/TNFRSF1B/CD120b (C-6His-Avi) Biotinylated
Sign In for Pricing
View Details 
