Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR10J1 Peptide - C-terminal region

OR10J1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HGMP07J, HSHGMP07J

UniProt

P30954

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR10J1 Rabbit Polyclonal Antibody (orb587677) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036483

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ASIAYLKPKSENTREHDQLISVTYTVITPLLNPVVYTLRNKEVKDALCRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC18 / Mucin 18 / CD146 (OJ79c), CF405S conjugate, 0.1mg/mL
BNC040676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF488A conjugate, 0.1mg/mL
BNC880342-100 1x 100 µL

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL
BNC700977-500 1x 500 µL

TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL
BNC400026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF488A conjugate, 0.1mg/mL
BNC880160-500 1x 500 µL

CD20 (B9E9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF488A conjugate, 0.1mg/mL
BNC880177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details