Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR51F2 Peptide - C-terminal region

OR51F2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-23

UniProt

Q8NH61

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR51F2 Rabbit Polyclonal Antibody (orb327069) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004753

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DCPCILLSYILIIRSVLSIASSEERRKAFNTCTSHISAVSIFYLPLISLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Absent In Melanoma 1-Like Protein (AIM1L) Antibody
abx037386-01 100 µg

Absent In Melanoma 1-Like Protein (AIM1L) Antibody

Sign In for Pricing
View Details
Absent In Melanoma 1-Like Protein (AIM1L) Antibody
abx037386-02 1 mg

Absent In Melanoma 1-Like Protein (AIM1L) Antibody

Sign In for Pricing
View Details
ZBTB8A Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-13584R-PE-Cy5.5 100 µL

ZBTB8A Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
8-Amino-2-naphthalenesulfonic acid 97%
A25271 25 g

8-Amino-2-naphthalenesulfonic acid 97%

Sign In for Pricing
View Details
Urtoxazumab
E40YR1175 1 mg

Urtoxazumab

Sign In for Pricing
View Details
Aste1 ORF Vector (Rat) (pORF)
12585016 1.0 µg DNA

Aste1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details