Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR51F2 Peptide - C-terminal region

OR51F2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-23

UniProt

Q8NH61

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR51F2 Rabbit Polyclonal Antibody (orb327069) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004753

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DCPCILLSYILIIRSVLSIASSEERRKAFNTCTSHISAVSIFYLPLISLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VASP Rabbit pAb
E45R20767N 50 ul

VASP Rabbit pAb

Sign In for Pricing
View Details
Hamster Oncostatin-M (OSM) ELISA Kit
MBS2802992-01 48 Tests

Hamster Oncostatin-M (OSM) ELISA Kit

Sign In for Pricing
View Details
Hamster Oncostatin-M (OSM) ELISA Kit
MBS2802992-02 96 Tests

Hamster Oncostatin-M (OSM) ELISA Kit

Sign In for Pricing
View Details
Hamster Oncostatin-M (OSM) ELISA Kit
MBS2802992-03 5x 96 Tests

Hamster Oncostatin-M (OSM) ELISA Kit

Sign In for Pricing
View Details
Hamster Oncostatin-M (OSM) ELISA Kit
MBS2802992-04 10x 96 Tests

Hamster Oncostatin-M (OSM) ELISA Kit

Sign In for Pricing
View Details
Goat Anti-Mouse IgA - AcalephFluor568
MBS8327918-01 0.1 mL

Goat Anti-Mouse IgA - AcalephFluor568

Sign In for Pricing
View Details