Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR52B2 Peptide - C-terminal region

OR52B2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-70

UniProt

Q96RD2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR52B2 Rabbit Polyclonal Antibody (orb587687) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004052

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LDVILIAVSYSLILRAVFRLPSQDARHKALSTCGSHLCVILMFYVPSFFT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEIL2 Lentiviral Activation Particles (m2)
sc-436404-LAC-2 200 µL

NEIL2 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
STAT6 Rabbit Polyclonal Antibody
ER40121 100 µL

STAT6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mpnd (NM_026530) Mouse Tagged ORF Clone Lentiviral Particle
MR218901L4V 200 µL

Mpnd (NM_026530) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
2- (3-Chlorophenyl) acetohydrazide
OR1063152 5 g

2- (3-Chlorophenyl) acetohydrazide

Sign In for Pricing
View Details
PRDX2 Antibody (Center)
MBS9206519-01 0.08 mL

PRDX2 Antibody (Center)

Sign In for Pricing
View Details
PRDX2 Antibody (Center)
MBS9206519-02 0.4 mL

PRDX2 Antibody (Center)

Sign In for Pricing
View Details