OR52B2 Peptide - C-terminal region
OR52B2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR11-70
UniProt
Q96RD2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR52B2 Rabbit Polyclonal Antibody (orb587687) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001004052
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LDVILIAVSYSLILRAVFRLPSQDARHKALSTCGSHLCVILMFYVPSFFT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15147328 1 Vial
Lentiviral mouse Vmn1r15 shRNA (UAS) - Lentiviral mouse Vmn1r15 shRNA (UAS, iRFP) plasmid
Sign In for Pricing
View Details 
495146 100 µL
UGT1A6 (UDP-Glucuronosyltransferase 1-6, UDP Glucuronosyltransferase 1 Family, Polypeptide A6)
Sign In for Pricing
View Details VKC80699-01 100 mg
1- (3,4-Dihydro-1H-2-benzopyran-7-yl) methanamine
Sign In for Pricing
View Details