Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR52B6 Peptide - C-terminal region

OR52B6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-47

UniProt

Q8NGF0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR52B6 Rabbit Polyclonal Antibody (orb327070) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005162

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VWYGLAAALLSTGLDIMLITVSYIHILQAVFRLLSQDARSKALSTCGSHI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human ALDH3A2 pAb
PA12433-01 50 μL

Rabbit Anti-Human ALDH3A2 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human ALDH3A2 pAb
PA12433-02 100 μL

Rabbit Anti-Human ALDH3A2 pAb

Sign In for Pricing
View Details
ATF2 discontinued
307065 100 µL

ATF2 discontinued

Sign In for Pricing
View Details
Deoxycytidine triphosphate
M22742-01 1 g

Deoxycytidine triphosphate

Sign In for Pricing
View Details
Deoxycytidine triphosphate
M22742-02 200 mg

Deoxycytidine triphosphate

Sign In for Pricing
View Details
Deoxycytidine triphosphate
M22742-03 500 mg

Deoxycytidine triphosphate

Sign In for Pricing
View Details