Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR52B6 Peptide - C-terminal region

OR52B6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-47

UniProt

Q8NGF0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR52B6 Rabbit Polyclonal Antibody (orb327070) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005162

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VWYGLAAALLSTGLDIMLITVSYIHILQAVFRLLSQDARSKALSTCGSHI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NMDAR2B (GRIN2B) Human shRNA Plasmid Kit (Locus ID 2904)
TR312609 1 Kit

NMDAR2B (GRIN2B) Human shRNA Plasmid Kit (Locus ID 2904)

Sign In for Pricing
View Details
TPT-172 HCl (R33)
MBS5784395 Inquire

TPT-172 HCl (R33)

Sign In for Pricing
View Details
GPKOW (G Patch Domain and KOW Motifs-containing Protein, G Patch Domain-Containing Protein 5, T54, Spp2, GPATC5, GPATCH5) (MaxLight 550)
MBS6419034-01 0.1 mL

GPKOW (G Patch Domain and KOW Motifs-containing Protein, G Patch Domain-Containing Protein 5, T54, Spp2, GPATC5, GPATCH5) (MaxLight 550)

Sign In for Pricing
View Details
GPKOW (G Patch Domain and KOW Motifs-containing Protein, G Patch Domain-Containing Protein 5, T54, Spp2, GPATC5, GPATCH5) (MaxLight 550)
MBS6419034-02 5x 0.1 mL

GPKOW (G Patch Domain and KOW Motifs-containing Protein, G Patch Domain-Containing Protein 5, T54, Spp2, GPATC5, GPATCH5) (MaxLight 550)

Sign In for Pricing
View Details
Firivumab Biosimilar - Research Grade
ICH5551-5mg 5 mg

Firivumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Rac1/2/3/CDC42 Polyclonal Antibody
UB-GEN-15636 100 µL

Rac1/2/3/CDC42 Polyclonal Antibody

Sign In for Pricing
View Details