Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR52E2 Peptide - C-terminal region

OR52E2 Peptide - C-terminal region

Product Specifications

UniProt

Q8NGJ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR52E2 Rabbit Polyclonal Antibody (orb587688) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005164

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RYIHILLANLYVVVPPMLNPVIYGVRTKQIYKCVKKILLQEQGMEKEEYL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Complement C5 ELISA Kit
CTK-302 96 Tests

Mouse Complement C5 ELISA Kit

Sign In for Pricing
View Details
FibuLin 7 (FBLN7) (NM_001128165) Human Tagged ORF Clone Lentiviral Particle
RC225606L4V 200 µL

FibuLin 7 (FBLN7) (NM_001128165) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CHAC1 Antibody
orb1320397-01 30 µL

CHAC1 Antibody

Sign In for Pricing
View Details
CHAC1 Antibody
orb1320397-02 50 μL

CHAC1 Antibody

Sign In for Pricing
View Details
CHAC1 Antibody
orb1320397-03 100 µL

CHAC1 Antibody

Sign In for Pricing
View Details
POC5 (NM_001099271) Human Tagged Lenti ORF Clone
RC211787L3 10 µg

POC5 (NM_001099271) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details