Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OVCH2 Peptide - C-terminal region

OVCH2 Peptide - C-terminal region

Product Specifications

UniProt

Q7RTZ1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OVCH2 Rabbit Polyclonal Antibody (orb327072) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IQSLNYPENYSDKANCDWIFQASKHHLIKLSFQSLEIEESGDCTSDYVTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cacng7 Mouse Gene Knockout Kit (CRISPR)
KN502437 1 Kit

Cacng7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Muscle tissue
CS700435 5x 5 µm

Tissue FFPE Sections, Muscle tissue

Sign In for Pricing
View Details
Mouse Amy1 activation kit by CRISPRa
GA200182 1 Kit

Mouse Amy1 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Regulator Of G Protein Signaling 6 (RGS6) ELISA Kit
RD-RGS6-Mu-01 96 Tests

Mouse Regulator Of G Protein Signaling 6 (RGS6) ELISA Kit

Sign In for Pricing
View Details
Mouse Regulator Of G Protein Signaling 6 (RGS6) ELISA Kit
RD-RGS6-Mu-02 48 Tests

Mouse Regulator Of G Protein Signaling 6 (RGS6) ELISA Kit

Sign In for Pricing
View Details
C9orf47 (NM_001142413) Human Over-expression Lysate
LY428076 100 µg

C9orf47 (NM_001142413) Human Over-expression Lysate

Sign In for Pricing
View Details