Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OVCH2 Peptide - C-terminal region

OVCH2 Peptide - C-terminal region

Product Specifications

UniProt

Q7RTZ1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OVCH2 Rabbit Polyclonal Antibody (orb327072) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IQSLNYPENYSDKANCDWIFQASKHHLIKLSFQSLEIEESGDCTSDYVTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC6 (Mucin 6 / Gastric Mucin) (MUC6/1553R), 0.2mg/mL
BNUB1553-100 1x 100 µL

MUC6 (Mucin 6 / Gastric Mucin) (MUC6/1553R), 0.2mg/mL

Sign In for Pricing
View Details
DNP Recombinant Monoclonal Rat Antibody (rLO-DNP-2), CF®647 Conjugate - Biotium Choice
P038-647-1ML 1x 1 mL

DNP Recombinant Monoclonal Rat Antibody (rLO-DNP-2), CF®647 Conjugate - Biotium Choice

Sign In for Pricing
View Details
SMN1 Human Gene Knockout Kit (CRISPR)
KN421108 1 Kit

SMN1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human IL-17A Protein (Sumo Tag)
PDEH101135-01 20 µg

Recombinant Human IL-17A Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human IL-17A Protein (Sumo Tag)
PDEH101135-02 100 µg

Recombinant Human IL-17A Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human IL-17A Protein (Sumo Tag)
PDEH101135-03 500 µg

Recombinant Human IL-17A Protein (Sumo Tag)

Sign In for Pricing
View Details