CDKN1A Peptide - N-terminal region
CDKN1A Peptide - N-terminal region
Product Specifications
Product Name Alternative
CAP20, CDKN1, CIP1, MDA-6, P21, SDI1, WAF1, p21CIP1
UniProt
Q6FI05
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CDKN1A Rabbit Polyclonal Antibody (orb573599) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
IHC, WB
NCBI Accession Number
NP_510867
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLEGDFAW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC401283 20 µg
Protein Z (PROZ) (NM_003891) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC401877-500 1x 500 µL
Cytokeratin, Multi (Epithelial Marker) (KRT/1877R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402552-100 1x 100 µL
AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2552), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472617-100 1x 100 µL
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2617), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LC401560 20 µg
PPAR alpha (PPARA) (NM_005036) Human Over-expression Lysate
Sign In for Pricing
View Details