CDKN1A Peptide - N-terminal region
CDKN1A Peptide - N-terminal region
Product Specifications
Product Name Alternative
CAP20, CDKN1, CIP1, MDA-6, P21, SDI1, WAF1, p21CIP1
UniProt
Q6FI05
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CDKN1A Rabbit Polyclonal Antibody (orb573599) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
IHC, WB
NCBI Accession Number
NP_510867
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLEGDFAW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Kir2.1 Recombinant Rabbit Monoclonal Antibody [JE54-56]](https://cdn.genprice.uk/products/992/68dd1c8e061270361ea8241f/imageurl/ha721227.webp)
HA721227 100 µL
Kir2.1 Recombinant Rabbit Monoclonal Antibody [JE54-56]
Sign In for Pricing
View Details 
LC401622 20 µg
Myostatin Propeptide (MSTN) (NM_005259) Human Over-expression Lysate
Sign In for Pricing
View Details