Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBL2 Peptide - C-terminal region

RBL2 Peptide - C-terminal region

Product Specifications

UniProt

B7Z913

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RBL2 Rabbit Polyclonal Antibody (orb573715) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NETMLSPREKIFYYFSNSPSKRLREINSMIRTGETPTKKRGILLEDGSES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT6 Rabbit Polyclonal Antibody
TA312080 100 µL

STAT6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Bcl2/Adenovirus E1B 19kDa Interacting Protein 3 (BNIP3)
MBS2081404-01 0.1 mL

APC-Linked Polyclonal Antibody to Bcl2/Adenovirus E1B 19kDa Interacting Protein 3 (BNIP3)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Bcl2/Adenovirus E1B 19kDa Interacting Protein 3 (BNIP3)
MBS2081404-02 0.2 mL

APC-Linked Polyclonal Antibody to Bcl2/Adenovirus E1B 19kDa Interacting Protein 3 (BNIP3)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Bcl2/Adenovirus E1B 19kDa Interacting Protein 3 (BNIP3)
MBS2081404-03 0.5 mL

APC-Linked Polyclonal Antibody to Bcl2/Adenovirus E1B 19kDa Interacting Protein 3 (BNIP3)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Bcl2/Adenovirus E1B 19kDa Interacting Protein 3 (BNIP3)
MBS2081404-04 1 mL

APC-Linked Polyclonal Antibody to Bcl2/Adenovirus E1B 19kDa Interacting Protein 3 (BNIP3)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Bcl2/Adenovirus E1B 19kDa Interacting Protein 3 (BNIP3)
MBS2081404-05 5 mL

APC-Linked Polyclonal Antibody to Bcl2/Adenovirus E1B 19kDa Interacting Protein 3 (BNIP3)

Sign In for Pricing
View Details