Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTA1 Peptide - N-terminal region

MTA1 Peptide - N-terminal region

Product Specifications

UniProt

Q13330

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTA1 Rabbit Polyclonal Antibody (orb574549) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001190187.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLIMLADKHAKEIEEESETTVEADLTDKQKHQLKHRELFLSRQYESLPAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CUTC/CGI-32 Protein (His Tag)
PKSH031114 100 µg

Recombinant Human CUTC/CGI-32 Protein (His Tag)

Sign In for Pricing
View Details
ALG9 Rabbit Polyclonal Antibody
TA373457 100 µL

ALG9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tasl Mouse Gene Knockout Kit (CRISPR)
KN500469 1 Kit

Tasl Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DL-6-Hydroxy Norleucine
TRC-H948855-5G 5 g

DL-6-Hydroxy Norleucine

Sign In for Pricing
View Details
Difuroyl Disulfide
TRC-D590560-2.5MG 2.5 mg

Difuroyl Disulfide

Sign In for Pricing
View Details
Human ACSS3 activation kit by CRISPRa
GA112488 1 Kit

Human ACSS3 activation kit by CRISPRa

Sign In for Pricing
View Details