Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTA1 Peptide - N-terminal region

MTA1 Peptide - N-terminal region

Product Specifications

UniProt

Q13330

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTA1 Rabbit Polyclonal Antibody (orb574549) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001190187.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLIMLADKHAKEIEEESETTVEADLTDKQKHQLKHRELFLSRQYESLPAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR2M2 Antibody
8G560-AAT 50 µg

OR2M2 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Small intestine
CS807897 5x 5 µm

Tissue FFPE Sections, Small intestine

Sign In for Pricing
View Details
Human LOC112267881 activation kit by CRISPRa
GA120009 1 Kit

Human LOC112267881 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human CD47/IAP Protein (Fc & Avi Tag)
PKSH033799-01 20 µg

Recombinant Human CD47/IAP Protein (Fc & Avi Tag)

Sign In for Pricing
View Details
Recombinant Human CD47/IAP Protein (Fc & Avi Tag)
PKSH033799-02 100 µg

Recombinant Human CD47/IAP Protein (Fc & Avi Tag)

Sign In for Pricing
View Details
Catenin, beta (CTNNB1) (rCTNNB1/2173), 0.2mg/mL
BNUB2173-500 1x 500 µL

Catenin, beta (CTNNB1) (rCTNNB1/2173), 0.2mg/mL

Sign In for Pricing
View Details