Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF655 Peptide - N-terminal region

ZNF655 Peptide - N-terminal region

Product Specifications

Product Name Alternative

VIK, VIK-1

UniProt

Q8N720

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF655 Rabbit Polyclonal Antibody (orb574730) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612503

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QITISKETFTSEKNNECHEPEKSFSLDSTIDADQRVLRIQNTDDNDKYDM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(±)Homoeriodictyol
TRC-D690970-250MG 250 mg

(±)Homoeriodictyol

Sign In for Pricing
View Details
Lymphocyte Specific Protein 1 (LSP1) / pp52 (LSP1/3025), 0.2mg/mL
BNUB3025-100 1x 100 µL

Lymphocyte Specific Protein 1 (LSP1) / pp52 (LSP1/3025), 0.2mg/mL

Sign In for Pricing
View Details
Sys1 Mouse Gene Knockout Kit (CRISPR)
KN517075 1 Kit

Sys1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tnip3 Mouse Gene Knockout Kit (CRISPR)
KN518008 1 Kit

Tnip3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS505040 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
galectin 9 (LGALS9) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI19H8]
TA805651AM 100 µL

galectin 9 (LGALS9) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI19H8]

Sign In for Pricing
View Details