Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF655 Peptide - N-terminal region

ZNF655 Peptide - N-terminal region

Product Specifications

Product Name Alternative

VIK, VIK-1

UniProt

Q8N720

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF655 Rabbit Polyclonal Antibody (orb574730) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612503

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QITISKETFTSEKNNECHEPEKSFSLDSTIDADQRVLRIQNTDDNDKYDM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT73 (C-term) Rabbit Polyclonal Antibody
AP52420PU-N 400 µL

KRT73 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Estrogen Receptor alpha Antibody
RC-16778-01 50 μL

Recombinant Estrogen Receptor alpha Antibody

Sign In for Pricing
View Details
Recombinant Estrogen Receptor alpha Antibody
RC-16778-02 100 µL

Recombinant Estrogen Receptor alpha Antibody

Sign In for Pricing
View Details
Recombinant Estrogen Receptor alpha Antibody
RC-16778-03 1 mL

Recombinant Estrogen Receptor alpha Antibody

Sign In for Pricing
View Details
PIK3R1 Antibody
KC-6264-01 50 μL

PIK3R1 Antibody

Sign In for Pricing
View Details
PIK3R1 Antibody
KC-6264-02 100 µL

PIK3R1 Antibody

Sign In for Pricing
View Details