KIF19 Peptide - middle region
KIF19 Peptide - middle region
Product Specifications
UniProt
Q2TAC6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KIF19 Rabbit Polyclonal Antibody (orb574889) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VSTINAKEIMQLLMKGNRQRTQEPTAANQTSSRSHAVLQVTVRQRSRVKN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9316308-01 48 Well
Human Small conductance calcium-activated potassium channel protein 3, KCNN3 ELISA Kit
Sign In for Pricing
View Details MBS9316308-02 96 Well
Human Small conductance calcium-activated potassium channel protein 3, KCNN3 ELISA Kit
Sign In for Pricing
View Details MBS9316308-03 5x 96 Well
Human Small conductance calcium-activated potassium channel protein 3, KCNN3 ELISA Kit
Sign In for Pricing
View Details MBS9316308-04 10x 96 Well
Human Small conductance calcium-activated potassium channel protein 3, KCNN3 ELISA Kit
Sign In for Pricing
View Details 
P4070-87H-ML750 100 µL
PHLPP, NT (PH Domain and Leucine Rich Repeat Protein Phosphatase 1, PH Domain Leucine-rich Repeat-containing Protein Phosphatase 1, PHLPP1, KIAA0606, MGC161555, Pleckstrin Homology Domain-containing Family E Member 1, PH Domain-containing Family E Member 1, PLEKHE1, Suprachiasmatic Nucleus Circadian Oscillatory Protein, SCN Circadian Oscillatory Protein, SCOP, hSCOP) (MaxLight 750) discontinued
Sign In for Pricing
View Details 