Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF19 Peptide - middle region

KIF19 Peptide - middle region

Product Specifications

UniProt

Q2TAC6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KIF19 Rabbit Polyclonal Antibody (orb574889) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VSTINAKEIMQLLMKGNRQRTQEPTAANQTSSRSHAVLQVTVRQRSRVKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3830431G21Rik ORF Vector (Mouse) (pORF)
10550014 1.0 µg DNA

3830431G21Rik ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Recombinant Dog Nitric oxide synthase, endothelial (NOS3), partial
MBS1433163 Inquire

Recombinant Dog Nitric oxide synthase, endothelial (NOS3), partial

Sign In for Pricing
View Details
Bmp5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
13368116 3x 1.0 µg

Bmp5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Anti-DNA Antibody (165.45)
MBS1568770-01 0.1 mg

Anti-DNA Antibody (165.45)

Sign In for Pricing
View Details
Anti-DNA Antibody (165.45)
MBS1568770-02 1 mg

Anti-DNA Antibody (165.45)

Sign In for Pricing
View Details
Anti-DNA Antibody (165.45)
MBS1568770-03 5x 1 mg

Anti-DNA Antibody (165.45)

Sign In for Pricing
View Details