KLHL41 Peptide - middle region
KLHL41 Peptide - middle region
Product Specifications
UniProt
O60662
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KLHL41 Rabbit Polyclonal Antibody (orb324522) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RFRLMTEKYFKDHVEKDDIIKSNPDLQKKIKVLKDAFAGKLPEPSKNAAK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GP-3101-40 1 mL
Colloidal Gold Conjugated Wisteria floribunda Lectin (Japanese Wisteria) -WFA-, 1mL 40nm
Sign In for Pricing
View Details ![EGF Recombinant Rabbit Monoclonal Antibody [JA14-15]](https://cdn.genprice.uk/products/992/68dd1c8d061270361ea81e74/imageurl/et1704-33.webp)
ET1704-33 100 µL
EGF Recombinant Rabbit Monoclonal Antibody [JA14-15]
Sign In for Pricing
View Details 
E-CL-H0246-01 24 Tests
Human AIF1 (Allograft Inflammatory Factor 1) CLIA Kit
Sign In for Pricing
View Details E-CL-H0246-02 48 Tests
Human AIF1 (Allograft Inflammatory Factor 1) CLIA Kit
Sign In for Pricing
View Details