KLHL41 Peptide - middle region
KLHL41 Peptide - middle region
Product Specifications
UniProt
O60662
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KLHL41 Rabbit Polyclonal Antibody (orb324522) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RFRLMTEKYFKDHVEKDDIIKSNPDLQKKIKVLKDAFAGKLPEPSKNAAK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![RING1 Mouse Monoclonal Antibody [Clone ID: OTI2D11]](https://cdn.genprice.uk/products/937/68dd18ba061270361e908537/imageurl/cf809239.webp)
CF809239 100 µg
RING1 Mouse Monoclonal Antibody [Clone ID: OTI2D11]
Sign In for Pricing
View Details 
AP22495PU-N 50 µg
HNF 4 alpha (HNF4A) (2-15) Goat Polyclonal Antibody
Sign In for Pricing
View Details 
BNC041780-100 1x 100 µL
CD8A (Cytotoxic- & Suppressor T-Cell Marker) (N/A), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 