Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRPM8 Peptide - N-terminal region

TRPM8 Peptide - N-terminal region

Product Specifications

UniProt

F8WD55

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRPM8 Rabbit Polyclonal Antibody (orb329830) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ARLSMRNRRNDTLDSTRTLYSSASRSTDLSYSESDLVNFIQANFKKRECV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal to Human EPHA4 / EPH Receptor A4
MBS240030-01 0.05 mg

Rabbit Polyclonal to Human EPHA4 / EPH Receptor A4

Sign In for Pricing
View Details
Rabbit Polyclonal to Human EPHA4 / EPH Receptor A4
MBS240030-02 5x 0.05 mg

Rabbit Polyclonal to Human EPHA4 / EPH Receptor A4

Sign In for Pricing
View Details
Plekha3 3'UTR Luciferase Stable Cell Line
TU116526 1.0 mL

Plekha3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
JAK2 Rabbit Polyclonal Antibody (Cy5.5)
orb1052244 100 µL

JAK2 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
MLF1 ORF Vector (Human) (pORF)
30187011 1.0 µg DNA

MLF1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
CGB5 Rabbit pAb
E2506486 100 µL

CGB5 Rabbit pAb

Sign In for Pricing
View Details