Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRPM8 Peptide - N-terminal region

TRPM8 Peptide - N-terminal region

Product Specifications

UniProt

F8WD55

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRPM8 Rabbit Polyclonal Antibody (orb329830) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ARLSMRNRRNDTLDSTRTLYSSASRSTDLSYSESDLVNFIQANFKKRECV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Synaptotagmin VII (SYT7)
TRV-0062628-01 10 µg

Recombinant Synaptotagmin VII (SYT7)

Sign In for Pricing
View Details
Recombinant Synaptotagmin VII (SYT7)
TRV-0062628-02 50 µg

Recombinant Synaptotagmin VII (SYT7)

Sign In for Pricing
View Details
Recombinant Synaptotagmin VII (SYT7)
TRV-0062628-03 100 µg

Recombinant Synaptotagmin VII (SYT7)

Sign In for Pricing
View Details
Recombinant Synaptotagmin VII (SYT7)
TRV-0062628-04 200 µg

Recombinant Synaptotagmin VII (SYT7)

Sign In for Pricing
View Details
Recombinant Synaptotagmin VII (SYT7)
TRV-0062628-05 500 µg

Recombinant Synaptotagmin VII (SYT7)

Sign In for Pricing
View Details
Recombinant Synaptotagmin VII (SYT7)
TRV-0062628-06 1 mg

Recombinant Synaptotagmin VII (SYT7)

Sign In for Pricing
View Details