Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FEV Peptide - C-terminal region

FEV Peptide - C-terminal region

Product Specifications

Product Name Alternative

HSRNAFEV, PET-1

UniProt

Q99581

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FEV Rabbit Polyclonal Antibody (orb575709) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_059991

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AAAAAAAQDGALYKLPAGLAPLPFPGLSKLNLMAASAGVAPAGFSYWPGP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1563072 Rat siRNA Oligo Duplex (Locus ID 313595)
SR504033 1 Kit

RGD1563072 Rat siRNA Oligo Duplex (Locus ID 313595)

Sign In for Pricing
View Details
Cdk4 Antibody
R31947 100 µg

Cdk4 Antibody

Sign In for Pricing
View Details
1- (6-Amino-1,2,3,4-tetrahydroquinolin-1-yl) ethan-1-one hydrochloride
KZB44174-01 250 mg

1- (6-Amino-1,2,3,4-tetrahydroquinolin-1-yl) ethan-1-one hydrochloride

Sign In for Pricing
View Details
1- (6-Amino-1,2,3,4-tetrahydroquinolin-1-yl) ethan-1-one hydrochloride
KZB44174-02 2.5 g

1- (6-Amino-1,2,3,4-tetrahydroquinolin-1-yl) ethan-1-one hydrochloride

Sign In for Pricing
View Details
Esrp2 Antibody
orb859562 2 mg

Esrp2 Antibody

Sign In for Pricing
View Details
PRSS21 Rabbit Polyclonal Antibody
E10G30982 100 µL

PRSS21 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details