Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDM6 Peptide - C-terminal region

PRDM6 Peptide - C-terminal region

Product Specifications

UniProt

Q9NQX0

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRDM6 Rabbit Polyclonal Antibody (orb575905) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FAGATTLNNHIRTHTGEKPFKCERCERSFTQATQLSRHQRMPNECKPITE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal MON1B Antibody
NBP3-05063-20ul 20 µL

Rabbit Polyclonal MON1B Antibody

Sign In for Pricing
View Details
OLIG1 (Oligodendrocyte Transcription Factor 1, Oligo1, Class B Basic Helix-loop-helix Protein 6, bHLHb6, Class E Basic Helix-loop-helix Protein 21, bHLHe21, BHLHB6, BHLHE21) APC
MBS6138007-01 0.1 mL

OLIG1 (Oligodendrocyte Transcription Factor 1, Oligo1, Class B Basic Helix-loop-helix Protein 6, bHLHb6, Class E Basic Helix-loop-helix Protein 21, bHLHe21, BHLHB6, BHLHE21) APC

Sign In for Pricing
View Details
OLIG1 (Oligodendrocyte Transcription Factor 1, Oligo1, Class B Basic Helix-loop-helix Protein 6, bHLHb6, Class E Basic Helix-loop-helix Protein 21, bHLHe21, BHLHB6, BHLHE21) APC
MBS6138007-02 5x 0.1 mL

OLIG1 (Oligodendrocyte Transcription Factor 1, Oligo1, Class B Basic Helix-loop-helix Protein 6, bHLHb6, Class E Basic Helix-loop-helix Protein 21, bHLHe21, BHLHB6, BHLHE21) APC

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR559729 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
[Ile7]-Angiotensin III
CCP1009-01 1 mg

[Ile7]-Angiotensin III

Sign In for Pricing
View Details
[Ile7]-Angiotensin III
CCP1009-02 5 mg

[Ile7]-Angiotensin III

Sign In for Pricing
View Details