Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDM6 Peptide - C-terminal region

PRDM6 Peptide - C-terminal region

Product Specifications

UniProt

Q9NQX0

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRDM6 Rabbit Polyclonal Antibody (orb575905) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FAGATTLNNHIRTHTGEKPFKCERCERSFTQATQLSRHQRMPNECKPITE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Host Cell Factor C2 (HCFC2), Recombinant, Human, His-Tag
050829-01 10 µg

Host Cell Factor C2 (HCFC2), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Host Cell Factor C2 (HCFC2), Recombinant, Human, His-Tag
050829-02 50 µg

Host Cell Factor C2 (HCFC2), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Host Cell Factor C2 (HCFC2), Recombinant, Human, His-Tag
050829-03 100 µg

Host Cell Factor C2 (HCFC2), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Host Cell Factor C2 (HCFC2), Recombinant, Human, His-Tag
050829-04 200 µg

Host Cell Factor C2 (HCFC2), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
JUN Antibody (T231) Blocking peptide
orb1452532 500 µg

JUN Antibody (T231) Blocking peptide

Sign In for Pricing
View Details
9-Ethyl-3- (1- (4-methoxyphenyl) -4,5-bis (4- (4-methylpiperazin-1-yl) phenyl) -1H-imidazol-2-yl) -9H-carbazole
OR1074582-01 5 mg

9-Ethyl-3- (1- (4-methoxyphenyl) -4,5-bis (4- (4-methylpiperazin-1-yl) phenyl) -1H-imidazol-2-yl) -9H-carbazole

Sign In for Pricing
View Details