STEAP2 Peptide - middle region
STEAP2 Peptide - middle region
Product Specifications
UniProt
Q8NFT2
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with STEAP2 Rabbit Polyclonal Antibody (orb576080) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PHVVDVTHHEDALTKTNIIFVAIHREHYTSLWDLRHLLVGKILIDVSNNM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LS100132911-100ug 100 µg
DPH3P1 (NM_080750) Human Over-expression Lysate
Sign In for Pricing
View Details 
MBS6367619-01 0.1 mL
ZNF736, NT (ZNF736, Zinc finger protein 736) (MaxLight 405)
Sign In for Pricing
View Details MBS6367619-02 5x 0.1 mL
ZNF736, NT (ZNF736, Zinc finger protein 736) (MaxLight 405)
Sign In for Pricing
View Details 