STEAP2 Peptide - middle region
STEAP2 Peptide - middle region
Product Specifications
UniProt
Q8NFT2
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with STEAP2 Rabbit Polyclonal Antibody (orb576080) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PHVVDVTHHEDALTKTNIIFVAIHREHYTSLWDLRHLLVGKILIDVSNNM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7010618-01 0.02 mg
Recombinant Human Transmembrane protein C9orf123 (C9orf123)
Sign In for Pricing
View Details MBS7010618-02 0.1 mg
Recombinant Human Transmembrane protein C9orf123 (C9orf123)
Sign In for Pricing
View Details MBS7010618-03 5x 0.1 mg
Recombinant Human Transmembrane protein C9orf123 (C9orf123)
Sign In for Pricing
View Details 
GR109157 50 mg
Genorise® Biotinylated Chicken IL-6 Polyclonal Antibody
Sign In for Pricing
View Details