Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOHLH1 Peptide - C-terminal region

SOHLH1 Peptide - C-terminal region

Product Specifications

UniProt

Q5JUK2

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SOHLH1 Rabbit Polyclonal Antibody (orb576438) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MGAAPLGEPAKEDPMLAQEAGSALGSDVDDGTSFLLTAGPSSWPGEWGPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant UPF0053 protein Mb2387c (Mb2387c)
MBS1146577 Inquire

Recombinant UPF0053 protein Mb2387c (Mb2387c)

Sign In for Pricing
View Details
Rabbit anti-FNTB Antibody
YLD3139-01 50 µL

Rabbit anti-FNTB Antibody

Sign In for Pricing
View Details
Rabbit anti-FNTB Antibody
YLD3139-02 100 µL

Rabbit anti-FNTB Antibody

Sign In for Pricing
View Details
Hamster Angiotensin II Receptor 2 Antibody (Anti-AT2R) ELISA Kit
MBS9926042-01 48 Well

Hamster Angiotensin II Receptor 2 Antibody (Anti-AT2R) ELISA Kit

Sign In for Pricing
View Details
Hamster Angiotensin II Receptor 2 Antibody (Anti-AT2R) ELISA Kit
MBS9926042-02 96 Well

Hamster Angiotensin II Receptor 2 Antibody (Anti-AT2R) ELISA Kit

Sign In for Pricing
View Details
Hamster Angiotensin II Receptor 2 Antibody (Anti-AT2R) ELISA Kit
MBS9926042-03 5x 96 Well

Hamster Angiotensin II Receptor 2 Antibody (Anti-AT2R) ELISA Kit

Sign In for Pricing
View Details