Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOHLH1 Peptide - C-terminal region

SOHLH1 Peptide - C-terminal region

Product Specifications

UniProt

Q5JUK2

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SOHLH1 Rabbit Polyclonal Antibody (orb576438) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MGAAPLGEPAKEDPMLAQEAGSALGSDVDDGTSFLLTAGPSSWPGEWGPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Immunoglobulin G1, IgG1 ELISA Kit
SL0284Mo-01 48 Tests

Mouse Immunoglobulin G1, IgG1 ELISA Kit

Sign In for Pricing
View Details
Mouse Immunoglobulin G1, IgG1 ELISA Kit
SL0284Mo-02 96 Tests

Mouse Immunoglobulin G1, IgG1 ELISA Kit

Sign In for Pricing
View Details
4-[ (2-Oxopiperazin-1-yl) methyl]benzonitrile hydrochloride
PJA07280-01 50 mg

4-[ (2-Oxopiperazin-1-yl) methyl]benzonitrile hydrochloride

Sign In for Pricing
View Details
4-[ (2-Oxopiperazin-1-yl) methyl]benzonitrile hydrochloride
PJA07280-02 0.5 g

4-[ (2-Oxopiperazin-1-yl) methyl]benzonitrile hydrochloride

Sign In for Pricing
View Details
Calpain inhibitor V
orb2276930-01 5 mg

Calpain inhibitor V

Sign In for Pricing
View Details
Calpain inhibitor V
orb2276930-02 50 mg

Calpain inhibitor V

Sign In for Pricing
View Details