Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF750 Peptide - N-terminal region

ZNF750 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ZFP750

UniProt

Q32MQ0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF750 Rabbit Polyclonal Antibody (orb577200) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078978

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MSLLKERKPKKPHYIPRPPGKPFKYKCFQCPFTCNEKSHLFNHMKYGLCK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ap1s2 AAV siRNA Pooled Vector
12104164 1.0 µg

Ap1s2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
APOE Adenovirus (Rat)
12182056 1.0 mL

APOE Adenovirus (Rat)

Sign In for Pricing
View Details
HRAS Antibody, HRP conjugated
CSB-PA010726LB01HU-01 50 µg

HRAS Antibody, HRP conjugated

Sign In for Pricing
View Details
HRAS Antibody, HRP conjugated
CSB-PA010726LB01HU-02 100 µg

HRAS Antibody, HRP conjugated

Sign In for Pricing
View Details
JTB Polyclonal Antibody
MBS9431309-01 0.05 mL

JTB Polyclonal Antibody

Sign In for Pricing
View Details
JTB Polyclonal Antibody
MBS9431309-02 0.1 mL

JTB Polyclonal Antibody

Sign In for Pricing
View Details