IKZF3 Peptide - middle region
IKZF3 Peptide - middle region
Product Specifications
UniProt
Q9UKT9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IKZF3 Rabbit Polyclonal Antibody (orb577247) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YACQRRDALTGHLRTHSVEKPYKCEFCGRSYKQRSSLEEHKERCRTFLQS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC941777-100 1x 100 µL
Prostate Specific Antigen (PSA) (3E6), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BA-8002-1 1 mg
Biotin Conjugated Bryonia dioica Lectin (White Bryony) -BDA-
Sign In for Pricing
View Details