IKZF3 Peptide - middle region
IKZF3 Peptide - middle region
Product Specifications
UniProt
Q9UKT9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IKZF3 Rabbit Polyclonal Antibody (orb577247) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YACQRRDALTGHLRTHSVEKPYKCEFCGRSYKQRSSLEEHKERCRTFLQS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSH032270-01 10 µg
Recombinant Human Complement Component C3a/C3a Protein
Sign In for Pricing
View Details PKSH032270-02 50 µg
Recombinant Human Complement Component C3a/C3a Protein
Sign In for Pricing
View Details 
![Ribonuclease 7 (RNASE7) Mouse Monoclonal Antibody [Clone ID: 4F9]](https://cdn.genprice.uk/products/937/68dd189e061270361e8fd5db/imageurl/am33436pu-n.webp)
AM33436PU-N 100 µg
Ribonuclease 7 (RNASE7) Mouse Monoclonal Antibody [Clone ID: 4F9]
Sign In for Pricing
View Details 