EMG1 Peptide - C-terminal region
EMG1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
C2F, Grcc2f, NEP1
UniProt
Q92979
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EMG1 Rabbit Polyclonal Antibody (orb577706) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_006322
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VSDVRELVPSSDPIVFVVGAFAHGKVSVEYTEKMVSISNYPLSAALTCAK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PDEH101079-02 100 µg
Recombinant Human TIMM9 protein (GST, His tag)
Sign In for Pricing
View Details PDEH101079-03 500 µg
Recombinant Human TIMM9 protein (GST, His tag)
Sign In for Pricing
View Details 
PKSV030363 100 µg
Recombinant SARS-CoV-2 Spike S1 (L18F, D80A, D215G, ΔLAL242-244, R246I, K417N, E484K, N501Y, D614G) (His Tag)
Sign In for Pricing
View Details 