Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EMG1 Peptide - C-terminal region

EMG1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C2F, Grcc2f, NEP1

UniProt

Q92979

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EMG1 Rabbit Polyclonal Antibody (orb577706) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006322

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VSDVRELVPSSDPIVFVVGAFAHGKVSVEYTEKMVSISNYPLSAALTCAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FHIT (NM_001166243) Human Recombinant Protein
TP328740 20 µg

FHIT (NM_001166243) Human Recombinant Protein

Sign In for Pricing
View Details
EGR2 (NM_001136178) Human Over-expression Lysate
LC427836 20 µg

EGR2 (NM_001136178) Human Over-expression Lysate

Sign In for Pricing
View Details
SRPK1 (N-term) Rabbit Polyclonal Antibody
AP13577PU-N 400 µL

SRPK1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GJB1 Rabbit Polyclonal Antibody
AP20645PU-N 100 µg

GJB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EDDHSA
TRC-E335105-10MG 10 mg

EDDHSA

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR562312 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details