Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRBD1 Peptide - C-terminal region

SRBD1 Peptide - C-terminal region

Product Specifications

UniProt

Q8N5C6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SRBD1 Rabbit Polyclonal Antibody (orb577823) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SADVEVTNEKQGKKKSKTAVNVLLKPNPLDQTCIHPESYDIAMRFLSSIG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit PKN1 (Protein Kinase N1) ELISA Kit
MBS2502263-01 24 Tests

Rabbit PKN1 (Protein Kinase N1) ELISA Kit

Sign In for Pricing
View Details
Rabbit PKN1 (Protein Kinase N1) ELISA Kit
MBS2502263-02 48 Tests

Rabbit PKN1 (Protein Kinase N1) ELISA Kit

Sign In for Pricing
View Details
Rabbit PKN1 (Protein Kinase N1) ELISA Kit
MBS2502263-03 96 Tests

Rabbit PKN1 (Protein Kinase N1) ELISA Kit

Sign In for Pricing
View Details
Rabbit PKN1 (Protein Kinase N1) ELISA Kit
MBS2502263-04 5x 96 Tests

Rabbit PKN1 (Protein Kinase N1) ELISA Kit

Sign In for Pricing
View Details
Rabbit PKN1 (Protein Kinase N1) ELISA Kit
MBS2502263-05 10x 96 Tests

Rabbit PKN1 (Protein Kinase N1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Bacillus cereus S-ribosylhomocysteine lyase (luxS)
MBS1127915-01 0.02 mg (E-Coli)

Recombinant Bacillus cereus S-ribosylhomocysteine lyase (luxS)

Sign In for Pricing
View Details