Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH1R Peptide - N-terminal region

PTH1R Peptide - N-terminal region

Product Specifications

UniProt

F2Z314

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTH1R Rabbit Polyclonal Antibody (orb578030) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ARIAPGLALLLCCPVLSSAYALVDADDVMTKEEQIFLLHRAQAQCEKRLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELF4 (NM_001421) Human Over-expression Lysate
LY400550 100 µg

ELF4 (NM_001421) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Phospho-PLCγ1 (Tyr783) Monoclonal Antibody
AN300148L-01 20 µL

Recombinant Phospho-PLCγ1 (Tyr783) Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Phospho-PLCγ1 (Tyr783) Monoclonal Antibody
AN300148L-02 100 µL

Recombinant Phospho-PLCγ1 (Tyr783) Monoclonal Antibody

Sign In for Pricing
View Details
BTC Antibody (Biotin)
KB-8154-01 50 μL

BTC Antibody (Biotin)

Sign In for Pricing
View Details
BTC Antibody (Biotin)
KB-8154-02 100 µL

BTC Antibody (Biotin)

Sign In for Pricing
View Details
BTC Antibody (Biotin)
KB-8154-03 1 mL

BTC Antibody (Biotin)

Sign In for Pricing
View Details