Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAM Peptide - C-terminal region

PAM Peptide - C-terminal region

Product Specifications

UniProt

A6NMH0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PAM Rabbit Polyclonal Antibody (orb578859) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLNLGNFFASRKGYSRKGFDRLSTEGSDQEKEDDGSESEEEYSAPLPALA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal MYH6 Antibody (CL2148)
NBP2-36744 0.1 mL

Mouse Monoclonal MYH6 Antibody (CL2148)

Sign In for Pricing
View Details
Soluble terminal complement complex SC5b9) Human ELISA Kit
H1899 96 Tests

Soluble terminal complement complex SC5b9) Human ELISA Kit

Sign In for Pricing
View Details
Thymidine Kinase 1/TK1 Antibody
AF6068-01 100 µL

Thymidine Kinase 1/TK1 Antibody

Sign In for Pricing
View Details
Thymidine Kinase 1/TK1 Antibody
AF6068-02 200 µL

Thymidine Kinase 1/TK1 Antibody

Sign In for Pricing
View Details
CENPA Antibody : FITC (OAAF00998-FITC)
OAAF00998-100UG-FITC 100 µg

CENPA Antibody : FITC (OAAF00998-FITC)

Sign In for Pricing
View Details
Lentiviral human GRAMD1B shRNA (UAS) - Lentiviral human GRAMD1B shRNA (UAS) (25)
GTR15090197 1 Vial

Lentiviral human GRAMD1B shRNA (UAS) - Lentiviral human GRAMD1B shRNA (UAS) (25)

Sign In for Pricing
View Details