PAM Peptide - C-terminal region
PAM Peptide - C-terminal region
Product Specifications
UniProt
A6NMH0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PAM Rabbit Polyclonal Antibody (orb578859) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GLNLGNFFASRKGYSRKGFDRLSTEGSDQEKEDDGSESEEEYSAPLPALA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1164278-01 0.02 mg (E-Coli)
Recombinant Trichophyton verrucosum Probable extracellular metalloproteinase 5 (MEP5)
Sign In for Pricing
View Details MBS1164278-02 0.02 mg (Yeast)
Recombinant Trichophyton verrucosum Probable extracellular metalloproteinase 5 (MEP5)
Sign In for Pricing
View Details MBS1164278-03 0.1 mg (E-Coli)
Recombinant Trichophyton verrucosum Probable extracellular metalloproteinase 5 (MEP5)
Sign In for Pricing
View Details MBS1164278-04 0.1 mg (Yeast)
Recombinant Trichophyton verrucosum Probable extracellular metalloproteinase 5 (MEP5)
Sign In for Pricing
View Details MBS1164278-05 0.02 mg (Baculovirus)
Recombinant Trichophyton verrucosum Probable extracellular metalloproteinase 5 (MEP5)
Sign In for Pricing
View Details