Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAM Peptide - C-terminal region

PAM Peptide - C-terminal region

Product Specifications

UniProt

A6NMH0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PAM Rabbit Polyclonal Antibody (orb578859) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLNLGNFFASRKGYSRKGFDRLSTEGSDQEKEDDGSESEEEYSAPLPALA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Acetyl-ginsenoside F1
orb1680300 5 mg

3-Acetyl-ginsenoside F1

Sign In for Pricing
View Details
Lentiviral mouse Vmn1r5 shRNA (UAS) - Lentiviral mouse Vmn1r5 shRNA (UAS) plasmid
GTR15137335 1 Vial

Lentiviral mouse Vmn1r5 shRNA (UAS) - Lentiviral mouse Vmn1r5 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Rat RAR Related Orphan Receptor Alpha (RORa) ELISA Kit
SL1413Ra-01 96 Tests

Rat RAR Related Orphan Receptor Alpha (RORa) ELISA Kit

Sign In for Pricing
View Details
Rat RAR Related Orphan Receptor Alpha (RORa) ELISA Kit
SL1413Ra-02 48 Tests

Rat RAR Related Orphan Receptor Alpha (RORa) ELISA Kit

Sign In for Pricing
View Details
PPID Antibody - middle region
ARP56625_P050-25UL 25 µL

PPID Antibody - middle region

Sign In for Pricing
View Details
Anti-CD148 Monoclonal Antibody (Clone:MEM-CD148/05)
30-1499-0.1 0.1 mg

Anti-CD148 Monoclonal Antibody (Clone:MEM-CD148/05)

Sign In for Pricing
View Details