Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAM Peptide - C-terminal region

PAM Peptide - C-terminal region

Product Specifications

UniProt

A6NMH0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PAM Rabbit Polyclonal Antibody (orb578859) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLNLGNFFASRKGYSRKGFDRLSTEGSDQEKEDDGSESEEEYSAPLPALA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carbonic anhydrase XII Antibody (Biotin)
abx432447 200 µL

Carbonic anhydrase XII Antibody (Biotin)

Sign In for Pricing
View Details
Indion® 810 Ion Exchange Resin (Strongly basic anion exchange resin) (Product of Ion Exchange India Ltd)
121450 1 kg

Indion® 810 Ion Exchange Resin (Strongly basic anion exchange resin) (Product of Ion Exchange India Ltd)

Sign In for Pricing
View Details
Mouse Monoclonal Layilin Antibody (328024) [PerCP]
FAB2637C 0.1 mL

Mouse Monoclonal Layilin Antibody (328024) [PerCP]

Sign In for Pricing
View Details
Npc1 Antibody
42-605 0.1 mg

Npc1 Antibody

Sign In for Pricing
View Details
GMPS, CT (GMP Synthase [Glutamine-hydrolyzing], Glutamine Amidotransferase, GMP Synthetase) (PE)
MBS6478648-01 0.2 mL

GMPS, CT (GMP Synthase [Glutamine-hydrolyzing], Glutamine Amidotransferase, GMP Synthetase) (PE)

Sign In for Pricing
View Details
GMPS, CT (GMP Synthase [Glutamine-hydrolyzing], Glutamine Amidotransferase, GMP Synthetase) (PE)
MBS6478648-02 5x 0.2 mL

GMPS, CT (GMP Synthase [Glutamine-hydrolyzing], Glutamine Amidotransferase, GMP Synthetase) (PE)

Sign In for Pricing
View Details