Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDST2 Peptide - C-terminal region

NDST2 Peptide - C-terminal region

Product Specifications

UniProt

J3KNC8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDST2 Rabbit Polyclonal Antibody (orb579482) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AVTSSFPSPSTFEEIQFFNSPNYHKGIDWYMDFFPVPSNASTDFLFEKSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat ACE2 Protein (His Tag)
PDMR100076-01 20 µg

Recombinant Rat ACE2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat ACE2 Protein (His Tag)
PDMR100076-02 100 µg

Recombinant Rat ACE2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat ACE2 Protein (His Tag)
PDMR100076-03 500 µg

Recombinant Rat ACE2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat ACE2 Protein (His Tag)
PDMR100076-04 1 mg

Recombinant Rat ACE2 Protein (His Tag)

Sign In for Pricing
View Details
Ɑ-Biotinamido-ω-Trimethoxysilylpropylurea PEG
133000-25-71.500MG 500 mg

Ɑ-Biotinamido-ω-Trimethoxysilylpropylurea PEG

Sign In for Pricing
View Details
MTCO2 (COX2) Rabbit Monoclonal Antibody [Clone ID: R05-2E2]
TA421488 100 µL

MTCO2 (COX2) Rabbit Monoclonal Antibody [Clone ID: R05-2E2]

Sign In for Pricing
View Details