NDST2 Peptide - C-terminal region
NDST2 Peptide - C-terminal region
Product Specifications
UniProt
J3KNC8
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NDST2 Rabbit Polyclonal Antibody (orb579482) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AVTSSFPSPSTFEEIQFFNSPNYHKGIDWYMDFFPVPSNASTDFLFEKSA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC942747-100 1x 100 µL
TCL1 (T-Cell Marker) (TCL1/2747R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
E-EL-M0093-01 24 Tests
Mouse ANGPTL4 (Angiopoietin Like Protein 4) ELISA Kit
Sign In for Pricing
View Details