Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAG1 Peptide - N-terminal region

STAG1 Peptide - N-terminal region

Product Specifications

UniProt

F8WCB3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STAG1 Rabbit Polyclonal Antibody (orb325720) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PRKSPGEKSRIEAGIRGAGRGRANGHPQQNGEGEPVTLFEVVKLGKSAMQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBR5 Polyclonal Antibody, Biotin Conjugated
bs-13052R-Biotin-01 20 µL

UBR5 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
UBR5 Polyclonal Antibody, Biotin Conjugated
bs-13052R-Biotin-02 100 µL

UBR5 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
USH1C siRNA (Human)
MBS8231688-01 15 nmol

USH1C siRNA (Human)

Sign In for Pricing
View Details
USH1C siRNA (Human)
MBS8231688-02 30 nmol

USH1C siRNA (Human)

Sign In for Pricing
View Details
USH1C siRNA (Human)
MBS8231688-03 5x 30 nmol

USH1C siRNA (Human)

Sign In for Pricing
View Details
LPCAT2 ELISA Kit (Human) (OKCD08953)
OKCD08953 96 Well

LPCAT2 ELISA Kit (Human) (OKCD08953)

Sign In for Pricing
View Details