Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAG1 Peptide - N-terminal region

STAG1 Peptide - N-terminal region

Product Specifications

UniProt

F8WCB3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STAG1 Rabbit Polyclonal Antibody (orb325720) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PRKSPGEKSRIEAGIRGAGRGRANGHPQQNGEGEPVTLFEVVKLGKSAMQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr181 (NM_001001030) Rat Tagged ORF Clone Lentiviral Particle
RR207513L3V 200 µL

Olr181 (NM_001001030) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
LRRTM2 Polyclonal Antibody, PerCP Conjugated
bs-11877R-PerCP 100 µL

LRRTM2 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
PLEKHG5 (HRP)
572560-01 50 µg

PLEKHG5 (HRP)

Sign In for Pricing
View Details
PLEKHG5 (HRP)
572560-02 100 µg

PLEKHG5 (HRP)

Sign In for Pricing
View Details
RFK Rabbit Polyclonal Antibody
orb1175160 100 µg

RFK Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse HTR5A Protein, His (Fc)-Avi-tagged
HTR5A-4379M 50 µg

Recombinant Mouse HTR5A Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details