Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

M1AP Peptide - middle region

M1AP Peptide - middle region

Product Specifications

UniProt

Q8TC57

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with M1AP Rabbit Polyclonal Antibody (orb325764) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EGLKDTDLARVRRFQVVEVTKGILEHVDSASPVEDTSNDESSILGTDIDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human UGT3A1 activation kit by CRISPRa
GA115206 1 Kit

Human UGT3A1 activation kit by CRISPRa

Sign In for Pricing
View Details
PLTP Rabbit Monoclonal Antibody
TA423724 100 µL

PLTP Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD14 Antibody[Sa14-2]
E-AB-F1176UI-01 25 µg

PE/Cyanine5.5 Anti-Mouse CD14 Antibody[Sa14-2]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD14 Antibody[Sa14-2]
E-AB-F1176UI-02 100 µg

PE/Cyanine5.5 Anti-Mouse CD14 Antibody[Sa14-2]

Sign In for Pricing
View Details
NCK1 Antibody
KC-4293-01 50 μL

NCK1 Antibody

Sign In for Pricing
View Details
NCK1 Antibody
KC-4293-02 100 µL

NCK1 Antibody

Sign In for Pricing
View Details