M1AP Peptide - middle region
M1AP Peptide - middle region
Product Specifications
UniProt
Q8TC57
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with M1AP Rabbit Polyclonal Antibody (orb325764) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EGLKDTDLARVRRFQVVEVTKGILEHVDSASPVEDTSNDESSILGTDIDL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC602009-500 1x 500 µL
CD4, Mouse (T-Cell Marker) (GK1.5), CF660C conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TP322965L 1 mg
Proteasome Activator Subunit 4 (PSME4) (NM_014614) Human Recombinant Protein
Sign In for Pricing
View Details 