VSTM5 Peptide - C-terminal region
VSTM5 Peptide - C-terminal region
Product Specifications
Product Name Alternative
C11orf90
UniProt
A8MXK1
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with VSTM5 Rabbit Polyclonal Antibody (orb587299) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001138343
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HFVAVILAFLAAVAAVLISLMWVCNKCAYKFQRKRRHKLKESTTEEIELE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC471994-100 1x 100 µL
MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (MMP3/1994R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![Kallikrein 8 (KLK8) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C10]](https://cdn.genprice.uk/products/937/68dd1b71061270361ea18979/imageurl/ta506138am.webp)
TA506138AM 100 µL
Kallikrein 8 (KLK8) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C10]
Sign In for Pricing
View Details 
BNUB1947-500 1x 500 µL
Cytokeratin 10 (Suprabasal Epithelial Marker) (rKRT10/1275), 0.2mg/mL
Sign In for Pricing
View Details