Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSTM5 Peptide - C-terminal region

VSTM5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C11orf90

UniProt

A8MXK1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VSTM5 Rabbit Polyclonal Antibody (orb587299) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138343

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HFVAVILAFLAAVAAVLISLMWVCNKCAYKFQRKRRHKLKESTTEEIELE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFAP Recombinant Monoclonal Mouse Antibody (rGA5), CF®568 Conjugate - Biotium Choice
P046-568-1ML 1x 1 mL

GFAP Recombinant Monoclonal Mouse Antibody (rGA5), CF®568 Conjugate - Biotium Choice

Sign In for Pricing
View Details
Vonoprazan M-1 Metabolite
TRC-V767090-250MG 250 mg

Vonoprazan M-1 Metabolite

Sign In for Pricing
View Details
4-Phenylbutanal
TRC-P320043-25MG 25 mg

4-Phenylbutanal

Sign In for Pricing
View Details
PGP9.5 (UCHL1) Human Gene Knockout Kit (CRISPR)
KN401803 1 Kit

PGP9.5 (UCHL1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PTau231 Antibody
KC-44758-01 50 μL

PTau231 Antibody

Sign In for Pricing
View Details
PTau231 Antibody
KC-44758-02 100 µL

PTau231 Antibody

Sign In for Pricing
View Details