ARL13A Peptide - C-terminal region
ARL13A Peptide - C-terminal region
Product Specifications
UniProt
Q5H913
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ARL13A Rabbit Polyclonal Antibody (orb326933) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TCQLPPTSSISISKNNTGSGERCSSHSFSTRTGMSKEKRQHLEQCSIEAK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![CCR5 Rabbit Monoclonal Antibody [Clone ID: E11/19]](https://cdn.genprice.uk/products/937/6868c2d0994c49e6dc3e7e0a/imageurl/ta386397.webp)
BNC470724-100 1x 100 µL
Thyroglobulin (2H11 + 6E1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880230-500 1x 500 µL
CD284 / TLR4 (TLR4/230), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details